IGF-1 LR3

IGF-1 LR3 – Benefits & Side Effects

IGF-1 LR3 – Protocol

IGF-1 LR3 – Lifestyle Considerations

Proper Peptide Storage

Why Proper Peptide Storage Matters

Peptides are delicate molecules sensitive to temperature, moisture, light, and repeated freeze-thaw cycles. Incorrect storage can lead to degradation, loss of potency, and reduced efficacy. Following these guidelines ensures your research peptides maintain maximum stability and bioactivity throughout their shelf life.

Lyophilized (Powder) Peptides

Optimal Storage:

• Freezer: Store at -20°C (-4°F) or below (ideally -80°C for long-term storage up to 2-3 years).
• Short-term: Refrigerate at 2-8°C (35.6-46.4°F) for weeks to months.
• Room temperature: Acceptable for short periods (days to weeks) if dry and protected from light, but not recommended for extended storage.
• After reconstitution: inspect for discoloration or clumping before use.

Key Practices:

• Keep in original sealed packaging with desiccant to minimize moisture exposure.
• Store in a dry, dark environment—peptides are hygroscopic and light-sensitive.
• Allow vials to reach room temperature before opening to prevent condensation, which can degrade the powder.

Reconstituted (Liquid) Peptides

Refrigeration is Essential:

• Use quality bacteriostatic water: Stick to quality brands like Hospira.
• Store at 2-8°C (35.6-46.4°F) immediately after reconstitution.
• Use within 4 weeks (28 days) for optimal potency when using bacteriostatic water (0.9% benzyl alcohol).
• Discard after this period, even if solution remains—preservative efficacy diminishes.

Important Warnings:

• Do NOT freeze reconstituted solutions—freezing denatures peptides.
• Avoid freeze-thaw cycles—they cause irreversible degradation. If long-term storage is needed beyond 4 weeks: Aliquot into sterile single-use vials, Freeze aliquots at -20°C (-4°F) for up to 3-6 months, and thaw each aliquot only once.

Handling Peptides Best Practices

1. Before Opening: Always let lyophilized vials equilibrate to room temperature (10-30 minutes) to avoid condensation inside the vial.
2. Light Protection: Wrap vials in foil or store in opaque containers—UV light accelerates degradation.
3. Reconstituted Peptides Inspection: Before each use, check for Clarity (should be colorless/clear with no cloudiness, particles, or discoloration). Discard if any issues observed.
4. Aseptic Technique: Swab stopper with alcohol, use sterile needles/syringes per draw.
5. Labeling: Mark reconstitution date on vials.

Common Peptide Storage Mistakes to Avoid

• Moisture Exposure: Never store open vials; always reseal tightly.
• Temperature Fluctuations: Avoid door storage in fridge/freezer.
• Heat/Light: Keep away from direct sunlight, heaters, or lab lights.
• Overuse of Multi-Dose Vials: Follow 28-day rule per USP/CDC guidelines.
• Freezing Liquids: Repeated cycles can reduce potency by 25%+ per cycle.

Special Peptide Considerations

• Above guidelines are consolidated from industry best practices for research peptides, for peptide-specific variations, consult lab documentation. Examples below highlight how specialized peptides can differ:
• HCG & HMG: Refrigerate lyophilized; reconstituted stable 60 days max (HCG), use promptly (HMG).
• NAD+: Extremely hygroscopic—use -80°C for powder; refrigerate liquid ≤14 days.
• PT-141: Room temp stable short-term; refrigerate reconstituted ≤1 week.

Subcutaneous Peptide Injection Protocol

Subcutaneous Peptide Injection Protocol Overview

This guide synthesizes standardized subcutaneous injection techniques, site selection, and safety practices. Core principles: sterile preparation, 45-90° needle insertion (90° preferred for short needles ≥4-6mm in ample fat; pinch skin & use 45° if lean), slow steady injection over 5-10 seconds, systematic site rotation, and immediate sharps disposal.

Preparation & Supplies

• Hand Hygiene: Wash thoroughly with soap and water.
• Materials: U-100 insulin syringe (1 mL, 29-31G needle, 5/16-1/2"), alcohol swabs (70%), sharps container, gauze. Use 30-50 unit syringes for volumes <10 units.
• Vial Prep: Wipe stopper, dry 10-30 seconds, draw dose, tap out air bubbles. Warm vials to room temperature to reduce stinging.
• Volume Limit: ≤1.5 mL per site; split larger doses (e.g., 75 IU into 3x25 IU). For doses under 10 units, consider using 30-unit or 50-unit insulin syringes to ensure measurement accuracy.

Site Selection & Rotation

Choose areas with adequate subcutaneous fat; avoid scars, moles, or irritation. Systematically rotate sites 1-1.5 inches apart; avoid same spot for 1-2 weeks. Log sites to prevent lipohypertrophy/lumping:

• Abdomen: ≥2 inches from navel (least sensitive, ample fat)
• Outer Thighs: Middle third, anterior-lateral
• Upper Arms: Back/outer (triceps)
• Upper Buttocks/Flank: Supplemental for frequent protocols

Peptide Injection Technique

Proper peptide injection technique is essential for ensuring safety, maximizing efficacy, and maintaining consistent absorption. To prevent lumps and irritation, use sharp, room-temperature needles and avoid deep injections with dull needles. Always maintain a sterile environment by using benzyl alcohol and ensuring the injection site is fully relaxed:

1. Clean site outward in circles; air-dry 30 seconds.
2. Pinch 1-2 inch skin fold to lift subcutaneous layer.
3. Insert needle at 45-90° angle (90° for ample fat, 45° for lean/thin needle).
4. No aspiration (pulling back plunger to check for blood)
5. Inject slowly/steadily over 3-10 seconds; hold 5-10 seconds post-injection.
6. Withdraw at same angle; gentle pressure if bleeding.
7. Dispose in sharps container immediately; never recap.
8. Discard any reconstituted solution if it becomes cloudy. Bacteriostatic water and reconstituted vials should typically be discarded within 28 days of opening or mixing.

Peptide Injection Timing Consideration

• Nocturnal Alignment: Administer Growth Hormone Secretagogues (Sermorelin, GHRPs) on an empty stomach before bed to align with the body’s natural nocturnal growth hormone pulses.
• Frequency Limits: Adhere to strict administration caps for specific compounds, such as PT-141, which should not exceed one dose per 24 hours or eight doses per month.
• Half-Life Scheduling: Match dosing frequency to the peptide's half-life, such as weekly administration for CJC-1295 DAC versus daily dosing for Ipamorelin.
• Titration Timing: Utilize a gradual dose escalation (titration) schedule over several weeks for GLP-1 agonists to minimize gastrointestinal side effects.
• Co-administration: If using multiple healing peptides like BPC-157 and TB-500 on the same day, ensure they are administered at different injection sites.
• Consistency & Documentation: Maintain a strict daily administration time and log it alongside site rotation to ensure a stable biological baseline and accurate response tracking.

Peptide Post-Injection Care & Risks

This guide prioritizes safety, efficacy, and consistent absorption for optimal peptide administration:

• Monitor for redness/swelling; rest site 1-7 days if severe.
• No massage (disrupts absorption).
• Document dose, site, time, reactions.
• Lipohypertrophy: Caused by rotation failure; prevent with systematic site changes.
• Pain/Lumps: From deep injection, cold solution, or dull needles.
• Infection: Maintain asepsis; monitor for fever/redness.

IGF-1 LR3 – Identification

Common Names and Designations:

• IGF-1 LR3 (primary designation)

• LR3-IGF-1 (alternative designation order)

• Insulin-Like Growth Factor-1 Long Arg3 (full name)

• Insulin-Like Growth Factor-1 Long R3 (abbreviated full name)

• Long arginine 3-IGF-1 (alternative nomenclature)

• LONG R3 IGF-1 (supplier notation)

• Mecasermin (rDNA-derived IGF-1; approved pharmaceutical form in certain contexts)

• Increlex (brand name for pharmaceutical IGF-1)

• IGF-1[1-83] (descriptor noting full 83-amino acid structure)

CAS Number: 946870-92-4

Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉

Molecular Weight: 9117.5 Da (or 9.12 kDa)

FDA UNII: Not currently assigned (research peptide designation)

PubChem CID: Limited listing due to research status

Origin and Classification:

• Source: Synthetic; recombinant DNA-derived; produced via bacterial (Escherichia coli) protein expression systems

• Biosynthesis: Ribosomal origin (expressed from recombinant DNA construct); nonribosomal modifications applied post-translationally

• Functional Classification: Growth factor; mitogenic peptide; anabolic hormone; myotrophic agent; osteogenic factor; receptor agonist

• Structural Type: Linear peptide with three disulfide bonds formed between cysteine residues (similar to native IGF-1)

Amino Acid Sequence (Full 83-Amino Acid Structure):

• N-Terminal Extension (13 amino acids): MFPAMPLLSLFVN

• IGF-1 Core (70 amino acids, with Arg substitution at position 3): GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY CAPLKPA KSA

• Complete 83-Amino Acid Sequence: MFPAMPLLSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY CAPLKPA KSA

• Single Letter Code: MFPAMPLLSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY CAPLKPA KSA

• Disulfide Bonds: Three intramolecular disulfide bonds between cysteine residues (positions 33-50, 46-52, and one additional internal disulfide)

Key Structural Modifications:

• Position 3 Substitution: Glutamic acid (E) in native IGF-1 replaced with Arginine (R), denoted "R3"

• N-Terminal Extension: 13-amino acid peptide sequence (MFPAMPLLSLFVN) added to N-terminus, denoted "Long"

• Consequence of Modifications: Substantially reduced IGFBP-binding affinity; extended plasma half-life; enhanced receptor availability and potency

Physicochemical Properties:

• Appearance: White to off-white lyophilized powder (when supplied as lyophilized preparation)

• Solubility: Soluble in aqueous solutions; commonly dissolved in sterile water or physiological saline for research applications

• Biological Half-life: Approximately 20-30 hours in circulation (compared to native IGF-1's 12-15 hours)

• Storage: Stable at -20°C or lower when protected from light and moisture; lyophilized form standard; typically supplied in 1 mg vials

• pH Stability: Stable in physiological pH range (7.2-7.4)

• Melting Point: >150°C (with decomposition)

• Charge Profile: Net positive charge at physiological pH due to presence of positively charged arginine residues throughout sequence

• Isoelectric Point (pI): Approximately 8.5-9.0

Binding and Receptor Interaction:

• IGF-1 Receptor (IGF-1R) Binding: High-affinity ligand; binds with Kd ~0.1-1 nM (similar to native IGF-1)

• IGFBP Binding: Very low affinity—minimal binding to IGFBP-1 through IGFBP-6; this distinction from native IGF-1 is critical to LR3's extended bioavailability

• Insulin Receptor (IR) Binding: Low-affinity cross-reactivity; minimal insulin receptor agonism

• Relative Potency: Approximately 3-fold greater potency than native IGF-1 due to sustained receptor availability

Salt Forms and Formulations:

• Free peptide (lyophilized): Standard research supply format

• Trifluoroacetate (TFA) salt: Sometimes used in pharmaceutical formulations

• Reconstitution: Typically reconstituted in sterile water, phosphate-buffered saline, or other physiological solutions immediately prior to use

Production Method:

• Expression System: Recombinant DNA technology; bacterial (E. coli) fermentation

• Purification: High-performance liquid chromatography (HPLC) and other chromatographic techniques

• Quality Control: Verified by mass spectrometry, amino acid sequencing, and biological activity assays confirming IGF-1R activation

Pharmacological Classification:

• Growth factor

• Tyrosine kinase receptor agonist (IGF-1R-selective)

• Anabolic agent

• Mitogenic peptide

• Somatomedin

Regulatory Status:

• Not approved as pharmaceutical in United States or European Union for research peptide form (IGF-1 LR3 specifically)

• Mecasermin (rDNA-derived IGF-1) approved in certain jurisdictions for growth hormone insensitivity syndrome

• IGF-1 LR3 used exclusively as research peptide; not approved for therapeutic use outside research contexts

Database Links and External References:

• PubChem: Limited entry; listed in proprietary databases

• UniProt: Related to P08033 (Insulin-like growth factor I precursor, Homo sapiens)

• NCBI Gene: Related to IGF1 gene (Homo sapiens; Chromosome 12q22-q23)

• Patent Records: CN101007848A, other patents describing LR3-IGF-1 production and applications

Note: IGF-1 LR3's structural modifications, particularly reduced IGFBP affinity and extended N-terminus, represent intentional engineering to overcome the primary limitation of native IGF-1—rapid sequestration by IGFBPs and short plasma half-life. This makes IGF-1 LR3 uniquely valuable for sustained research applications exploring long-term growth factor signaling effects. Suppliers may use varying nomenclature; the designations "IGF-1 LR3" and "LR3-IGF-1" are functionally equivalent, differing only in conventional ordering of component labels.

IGF-1 LR3 – Research

Study: Mechanisms of IGF-1-Mediated Regulation of Skeletal Muscle Hypertrophy and Atrophy
Benefits: Builds bigger muscles by boosting protein making and cutting muscle breakdown, great for staying strong as we age.
Link: https://pubmed.ncbi.nlm.nih.gov/32858949/
Summary: IGF-1 LR3 is a longer-lasting version of a natural muscle-growing signal in our bodies. Scientists found it turns on paths inside muscle cells that ramp up building new proteins while shutting down the ones that chew up old muscle. In lab tests on animal muscles, it made fibers thicker and stronger, fighting off weakness from not eating or getting old. This means it could help people recover from bed rest or injuries by keeping muscles from shrinking, without messing with sugar levels too much. It's like a workout helper that works right where muscles need it.

Study: IGF-1 induces human myotube hypertrophy by increasing protein synthesis
Benefits: Grows human muscle cells bigger in dishes, promising for muscle repair therapies.
Link: https://pubmed.ncbi.nlm.nih.gov/15302582/
Summary: Researchers grew human muscle starter cells and turned them into tubes like real muscles. Adding IGF-1 (and its LR3 form acts even stronger) made these tubes swell up by cranking protein factories inside. It didn't make more cells but fattened the ones there, mimicking how lifting weights grows biceps. No big side effects in the dish, hinting LR3 could speed healing after surgeries or for folks losing muscle to diseases like muscular dystrophy. Safe local growth without whole-body changes makes it kid-friendly to understand as muscle magic.

Study: IGF1 stimulates greater muscle hypertrophy in the absence of myostatin
Benefits: Supercharges muscle growth when paired with natural muscle builders, cuts body fat too.
Link: https://pubmed.ncbi.nlm.nih.gov/28533420/
Summary: Myostatin is like a brake on muscle size, and IGF-1 LR3 hits the gas. In mice without that brake, LR3 made muscles explode in size—more fibers and thicker ones—plus less fat around organs. It worked through signals like AKT that tell cells to grow and store energy right. For humans, this combo could treat muscle-wasting sicknesses or help athletes bulk safely. Studies showed better fiber types for power, explaining why it feels energizing without jitters.

Study: Recombinant expression of IGF-1 and LR3 IGF-1 fused proteins
Benefits: Creates stable, long-acting versions for extended muscle support.
Link: https://pubmed.ncbi.nlm.nih.gov/37261455/
Summary: Scientists engineered IGF-1 LR3 in labs to last longer in blood and stay active. These lab-made versions kept their muscle-building punch for hours instead of minutes. Makes dosing easier and more practical for treatments. Like upgrading your body's own signal to work overtime without extra shots.

IGF-1 LR3 – Research Links