LL-37

LL-37 – Benefits & Side Effects

LL-37 – Protocol

LL-37 – Lifestyle Considerations

Proper Peptide Storage

Why Proper Peptide Storage Matters

Peptides are delicate molecules sensitive to temperature, moisture, light, and repeated freeze-thaw cycles. Incorrect storage can lead to degradation, loss of potency, and reduced efficacy. Following these guidelines ensures your research peptides maintain maximum stability and bioactivity throughout their shelf life.

Lyophilized (Powder) Peptides

Optimal Storage:

• Freezer: Store at -20°C (-4°F) or below (ideally -80°C for long-term storage up to 2-3 years).
• Short-term: Refrigerate at 2-8°C (35.6-46.4°F) for weeks to months.
• Room temperature: Acceptable for short periods (days to weeks) if dry and protected from light, but not recommended for extended storage.
• After reconstitution: inspect for discoloration or clumping before use.

Key Practices:

• Keep in original sealed packaging with desiccant to minimize moisture exposure.
• Store in a dry, dark environment—peptides are hygroscopic and light-sensitive.
• Allow vials to reach room temperature before opening to prevent condensation, which can degrade the powder.

Reconstituted (Liquid) Peptides

Refrigeration is Essential:

• Use quality bacteriostatic water: Stick to quality brands like Hospira.
• Store at 2-8°C (35.6-46.4°F) immediately after reconstitution.
• Use within 4 weeks (28 days) for optimal potency when using bacteriostatic water (0.9% benzyl alcohol).
• Discard after this period, even if solution remains—preservative efficacy diminishes.

Important Warnings:

• Do NOT freeze reconstituted solutions—freezing denatures peptides.
• Avoid freeze-thaw cycles—they cause irreversible degradation. If long-term storage is needed beyond 4 weeks: Aliquot into sterile single-use vials, Freeze aliquots at -20°C (-4°F) for up to 3-6 months, and thaw each aliquot only once.

Handling Peptides Best Practices

1. Before Opening: Always let lyophilized vials equilibrate to room temperature (10-30 minutes) to avoid condensation inside the vial.
2. Light Protection: Wrap vials in foil or store in opaque containers—UV light accelerates degradation.
3. Reconstituted Peptides Inspection: Before each use, check for Clarity (should be colorless/clear with no cloudiness, particles, or discoloration). Discard if any issues observed.
4. Aseptic Technique: Swab stopper with alcohol, use sterile needles/syringes per draw.
5. Labeling: Mark reconstitution date on vials.

Common Peptide Storage Mistakes to Avoid

• Moisture Exposure: Never store open vials; always reseal tightly.
• Temperature Fluctuations: Avoid door storage in fridge/freezer.
• Heat/Light: Keep away from direct sunlight, heaters, or lab lights.
• Overuse of Multi-Dose Vials: Follow 28-day rule per USP/CDC guidelines.
• Freezing Liquids: Repeated cycles can reduce potency by 25%+ per cycle.

Special Peptide Considerations

• Above guidelines are consolidated from industry best practices for research peptides, for peptide-specific variations, consult lab documentation. Examples below highlight how specialized peptides can differ:
• HCG & HMG: Refrigerate lyophilized; reconstituted stable 60 days max (HCG), use promptly (HMG).
• NAD+: Extremely hygroscopic—use -80°C for powder; refrigerate liquid ≤14 days.
• PT-141: Room temp stable short-term; refrigerate reconstituted ≤1 week.

Subcutaneous Peptide Injection Protocol

Subcutaneous Peptide Injection Protocol Overview

This guide synthesizes standardized subcutaneous injection techniques, site selection, and safety practices. Core principles: sterile preparation, 45-90° needle insertion (90° preferred for short needles ≥4-6mm in ample fat; pinch skin & use 45° if lean), slow steady injection over 5-10 seconds, systematic site rotation, and immediate sharps disposal.

Preparation & Supplies

• Hand Hygiene: Wash thoroughly with soap and water.
• Materials: U-100 insulin syringe (1 mL, 29-31G needle, 5/16-1/2"), alcohol swabs (70%), sharps container, gauze. Use 30-50 unit syringes for volumes <10 units.
• Vial Prep: Wipe stopper, dry 10-30 seconds, draw dose, tap out air bubbles. Warm vials to room temperature to reduce stinging.
• Volume Limit: ≤1.5 mL per site; split larger doses (e.g., 75 IU into 3x25 IU). For doses under 10 units, consider using 30-unit or 50-unit insulin syringes to ensure measurement accuracy.

Site Selection & Rotation

Choose areas with adequate subcutaneous fat; avoid scars, moles, or irritation. Systematically rotate sites 1-1.5 inches apart; avoid same spot for 1-2 weeks. Log sites to prevent lipohypertrophy/lumping:

• Abdomen: ≥2 inches from navel (least sensitive, ample fat)
• Outer Thighs: Middle third, anterior-lateral
• Upper Arms: Back/outer (triceps)
• Upper Buttocks/Flank: Supplemental for frequent protocols

Peptide Injection Technique

Proper peptide injection technique is essential for ensuring safety, maximizing efficacy, and maintaining consistent absorption. To prevent lumps and irritation, use sharp, room-temperature needles and avoid deep injections with dull needles. Always maintain a sterile environment by using benzyl alcohol and ensuring the injection site is fully relaxed:

1. Clean site outward in circles; air-dry 30 seconds.
2. Pinch 1-2 inch skin fold to lift subcutaneous layer.
3. Insert needle at 45-90° angle (90° for ample fat, 45° for lean/thin needle).
4. No aspiration (pulling back plunger to check for blood)
5. Inject slowly/steadily over 3-10 seconds; hold 5-10 seconds post-injection.
6. Withdraw at same angle; gentle pressure if bleeding.
7. Dispose in sharps container immediately; never recap.
8. Discard any reconstituted solution if it becomes cloudy. Bacteriostatic water and reconstituted vials should typically be discarded within 28 days of opening or mixing.

Peptide Injection Timing Consideration

• Nocturnal Alignment: Administer Growth Hormone Secretagogues (Sermorelin, GHRPs) on an empty stomach before bed to align with the body’s natural nocturnal growth hormone pulses.
• Frequency Limits: Adhere to strict administration caps for specific compounds, such as PT-141, which should not exceed one dose per 24 hours or eight doses per month.
• Half-Life Scheduling: Match dosing frequency to the peptide's half-life, such as weekly administration for CJC-1295 DAC versus daily dosing for Ipamorelin.
• Titration Timing: Utilize a gradual dose escalation (titration) schedule over several weeks for GLP-1 agonists to minimize gastrointestinal side effects.
• Co-administration: If using multiple healing peptides like BPC-157 and TB-500 on the same day, ensure they are administered at different injection sites.
• Consistency & Documentation: Maintain a strict daily administration time and log it alongside site rotation to ensure a stable biological baseline and accurate response tracking.

Peptide Post-Injection Care & Risks

This guide prioritizes safety, efficacy, and consistent absorption for optimal peptide administration:

• Monitor for redness/swelling; rest site 1-7 days if severe.
• No massage (disrupts absorption).
• Document dose, site, time, reactions.
• Lipohypertrophy: Caused by rotation failure; prevent with systematic site changes.
• Pain/Lumps: From deep injection, cold solution, or dull needles.
• Infection: Maintain asepsis; monitor for fever/redness.

LL-37 – Identification

Common Names: LL-37, ropocamptide, CAP-18, hCAP-18, Cathelicidin LL-37, Cathelicidin-related antimicrobial peptide, CRAMP (murine homolog), Human cathelicidin

CAS Number: 154947-66-7 (primary, human LL-37); alternative designations for LL-37 acetate and other salt forms

Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃

Molecular Weight: 4493.37 g/mol (4493 Da commonly cited)

Origin & Type Classification:

• Source: Natural; endogenously produced in human immune cells, epithelial cells, and other tissues

• Biosynthesis: Ribosomal; encoded by the CAMP gene, translated as hCAP-18 precursor, then proteolytically activated to LL-37

• Functional Class: Antimicrobial peptide; cationic, amphipathic peptide; immune effector molecule; immunomodulator

Additional Information:

• Amino Acid Sequence: H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH; single-letter code: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

• Sequence Length: 37 amino acids

• Structural Type: Linear, α-helical peptide with helix-bend-helix motif in lipid environments

• Charge State: Net positive charge of +6 at physiological pH

• Structural Features: Amphipathic structure with hydrophobic and hydrophilic domains; N-terminal leucines (LL) characteristic of the naming; aromatic phenylalanines (F) at positions 5, 6, 17, 27

• Secondary Structure: Curved amphipathic helix-bend-helix spanning residues 2-31, followed by disordered C-terminal tail

• Salt Form: Available as free peptide, acetate salt, or other counter ions; lyophilized powder common

• Processing: Produced via proteolytic cleavage of hCAP-18 between alanine and leucine residues by serine proteases

• Known Synonyms: Ropocamptide (INN), CAP-18, hCAP-18 (precursor), CRAMP (murine equivalent), cathelicidin-related antimicrobial peptide

• Supplier Identification: PubChem CID 16198951 (human LL-37); available from multiple research suppliers

Database Links:

• PubChem: CID 16198951 (LL-37); CID 134611881 (cathelicidin LL-37 human)

• UniProt: Not applicable; LL-37 is a cleaved fragment of protein product CAMP (uniprot ID P49913)

• PDB: 2K6O (LL-37 structure in SDS micelles)

• NCBI: Gene ID 816 (CAMP gene); extensive literature database

Important Note: LL-37 represents the mature, active 37-amino acid form; additional shorter processing forms (such as KR-12 residues 18-29) may be generated by proteolytic degradation with distinct antimicrobial properties.

LL-37 – Research

Study: Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers
Benefits: Speeds up healing of stubborn leg sores, shrinking them by half or more safely.
Link: https://pubmed.ncbi.nlm.nih.gov/25041740/
Summary: People with tough-to-heal leg ulcers from poor blood flow tried LL-37 cream. Lower doses (0.5 and 1.6 mg/mL) made sores heal six times faster than fake cream, cutting size by 68% and 50%. Higher dose matched placebo, but all were super safe—no extra pain or infections. Ulcers got smaller quick, letting folks walk better sooner. Like a magic bandage that fights germs and pulls wound edges together, perfect for grandma's legs after long standing jobs.

Study: LL-37, the master antimicrobial peptide, its multifaceted role from combating infections to cancer immunity
Benefits: Kills bacteria, fungi, viruses, and even helps fight cancer by boosting immunity.
Link: https://pubmed.ncbi.nlm.nih.gov/39643165/
Summary: LL-37 punches holes in germ walls, stops fungi growing, blocks viruses entering cells, and rallies immune troops. It also zaps cancer cells directly and tweaks body defenses to attack tumors better. Safe in tests, no resistance buildup like antibiotics. From skin infections to gut bugs or even tumors, it's a multi-tool fighter. Imagine a tiny soldier patrolling your body, wiping out invaders before fevers start, keeping playtime sickness-free.

Study: Efficacy of LL-37 cream in enhancing healing of diabetic foot ulcer
Benefits: Heals foot sores in diabetes faster, fights infection and grows new skin.
Link: https://pmc.ncbi.nlm.nih.gov/articles/PMC10514151/
Summary: Diabetics with foot ulcers used LL-37 cream; inflammation dropped, new tissue grew thick, and sores closed quicker than standard care. It killed bacteria hiding deep and sped cell migration to cover holes. No extra sugar control issues. For folks with numb feet prone to cuts, this means fewer amputations and back on feet dancing. Like a deep clean and super glue for hard-to-heal spots from bad circulation.

Study: Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: A multicentric prospective randomized placebo-controlled clinical trial
Benefits: Proven in big trials to shrink chronic ulcers, safe for repeated use.
Link: https://pubmed.ncbi.nlm.nih.gov/34687253/
Summary: Across multiple clinics, LL-37 beat placebo on tough leg ulcers not healing with wraps alone. Wounds improved steadily over weeks, with better skin quality underneath. No serious sides, even in older patients. Builds on first trials, confirming reliability. Think reliable helper for circulation woes, turning months of bandages into weeks of smooth skin.

LL-37 – Research Links